PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR01G23630.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 320aa    MW: 34926.2 Da    PI: 10.1783
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR01G23630.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.41.3e-1688135148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+WT+eEde l++ v++ G ++W+t +r+ g+ R++k+c++rw +yl
  LPERR01G23630.1  88 RGPWTPEEDEVLARFVAREGCDRWRTLPRRAGLLRCGKSCRLRWMNYL 135
                      89******************************99************97 PP

2Myb_DNA-binding46.86.8e-15146186648
                      HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +E++l+v+++++lG++ W++Ia +++ gRt++++k++w+++l
  LPERR01G23630.1 146 DDEEDLIVRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 186
                      68***************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.9983135IPR017930Myb domain
SuperFamilySSF466891.46E-2785182IPR009057Homeodomain-like
SMARTSM007171.3E-1087137IPR001005SANT/Myb domain
PfamPF002491.6E-1488135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-2189142IPR009057Homeodomain-like
CDDcd001671.06E-990135No hitNo description
PROSITE profilePS5129424.529136190IPR017930Myb domain
SMARTSM007172.7E-13140188IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.3E-24143191IPR009057Homeodomain-like
CDDcd001673.94E-11146186No hitNo description
PfamPF002494.0E-13147186IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0010468Biological Processregulation of gene expression
GO:0048354Biological Processmucilage biosynthetic process involved in seed coat development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MWRCGARREK SVHKPLSRLA TQPRKRSPAR TTPTLSASGC VTLAGNRRKQ AARARLSAPI  60
GRIDRSMRQK RPARRGGDDE AAAPQLKRGP WTPEEDEVLA RFVAREGCDR WRTLPRRAGL  120
LRCGKSCRLR WMNYLRPDIK RSPIADDEED LIVRLHRLLG NRWSLIAGRL PGRTDNEIKN  180
YWNSHLSKKL IAQGIDPRTH RPLAATADHS NAAAASYETP VATNPPRVAP SVTAQPSSPA  240
AAGNGGSHDD LAQPADGGGD FAAMGISAPD ADGFGDQFFG EDAARGGFDM GSAMVDDDFS  300
SFLDSLINDE IGQGDVLEFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-28841903108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1082590.0AK108259.1 Oryza sativa Japonica Group cDNA clone:002-141-A12, full insert sequence.
GenBankD886200.0D88620.1 Oryza sativa mRNA for OSMYB4, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644524.11e-115PREDICTED: transcription repressor MYB5
SwissprotQ388503e-73MYB5_ARATH; Transcription repressor MYB5
TrEMBLA0A0D9V4I40.0A0A0D9V4I4_9ORYZ; Uncharacterized protein
STRINGLOC_Os01g50110.11e-115(Oryza sativa Japonica Group)
STRINGORGLA01G0227100.11e-115(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.12e-67myb domain protein 5